Lineage for d4jwka_ (4jwk A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173768Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 1173778Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 1173779Protein automated matches [193326] (2 species)
    not a true protein
  7. 1173780Species Acinetobacter baumannii [TaxId:575584] [196867] (2 PDB entries)
  8. 1173782Domain d4jwka_: 4jwk A: [197257]
    automated match to d2ptha_
    protein/RNA complex; complexed with ctn

Details for d4jwka_

PDB Entry: 4jwk (more details), 1.87 Å

PDB Description: Crystal structure of the complex of peptidyl-tRNA hydrolase from Acinetobacter baumannii with cytidine at 1.87 A resolution
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4jwka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jwka_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

SCOPe Domain Coordinates for d4jwka_:

Click to download the PDB-style file with coordinates for d4jwka_.
(The format of our PDB-style files is described here.)

Timeline for d4jwka_: