SCOP 1.73: Domain d1cdja1: 1cdj A:1-97

Lineage for d1cdja1 (1cdj A:1-97)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (25 PDB entries)

8. Domain d1cdja1: 1cdj A:1-97 [19725]
   Other proteins in same PDB: d1cdja2
   domain 1

Details for d1cdja1

PDB Entry: 1cdj, 2.5 Å

PDB Description: structure of t-cell surface glycoprotein cd4

PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d1cdja1:

Sequence; same for both SEQRES and ATOM records:

>d1cdja1 b.1.1.1 (A:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d1cdja1:

• d1cdja1 first appeared (with stable ids) in SCOP 1.55, called d1cdj_1
  
• d1cdja1 was called d1cdj_1 in SCOP 1.71
  
• d1cdja1 appears in SCOP 1.75
  
• d1cdja1 appears in the current release, SCOPe 2.08