Lineage for d4gdab_ (4gda B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1133645Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1133646Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1133647Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1133951Protein automated matches [190191] (2 species)
    not a true protein
  7. 1134019Species Streptomyces avidinii [TaxId:1895] [189343] (8 PDB entries)
  8. 1134020Domain d4gdab_: 4gda B: [197244]
    automated match to d1swgd_
    complexed with btn, eoh, gol, so4

Details for d4gdab_

PDB Entry: 4gda (more details), 1 Å

PDB Description: circular permuted streptavidin a50/n49
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d4gdab_:

Sequence, based on SEQRES records: (download)

>d4gdab_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
aesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwl
ltsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadga
ltgtyesavgn

Sequence, based on observed residues (ATOM records): (download)

>d4gdab_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
aesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwl
ltsgtteanawkstlvghdtftkvkpaeagitgtwynqlgstfivtagadgaltgtyesa
vgn

SCOPe Domain Coordinates for d4gdab_:

Click to download the PDB-style file with coordinates for d4gdab_.
(The format of our PDB-style files is described here.)

Timeline for d4gdab_: