Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins) |
Protein CD4 V-set domains [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (15 PDB entries) |
Domain d1gc1c1: 1gc1 C:1-97 [19724] Other proteins in same PDB: d1gc1c2, d1gc1g_, d1gc1h1, d1gc1h2, d1gc1l1, d1gc1l2 domain 1 |
PDB Entry: 1gc1 (more details), 2.5 Å
SCOP Domain Sequences for d1gc1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gc1c1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens)} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1gc1c1: