SCOP 1.61: Domain d1gc1c1: 1gc1 C:1-97

Lineage for d1gc1c1 (1gc1 C:1-97)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein N-terminal domain of CD4 [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries)

8. Domain d1gc1c1: 1gc1 C:1-97 [19724]
   Other proteins in same PDB: d1gc1c2, d1gc1g_, d1gc1h1, d1gc1h2, d1gc1l1, d1gc1l2

Details for d1gc1c1

PDB Entry: 1gc1, 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody

SCOP Domain Sequences for d1gc1c1:

Sequence; same for both SEQRES and ATOM records:

>d1gc1c1 b.1.1.1 (C:1-97) N-terminal domain of CD4 {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d1gc1c1:

• d1gc1c1 first appeared (with stable ids) in SCOP 1.55
  
• d1gc1c1 appears in SCOP 1.59
  
• d1gc1c1 appears in SCOP 1.63
  
• d1gc1c1 appears in the current release, SCOPe 2.08