SCOPe 2.04: Domain d4fcma_: 4fcm A:

Lineage for d4fcma_ (4fcm A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189642] (3 PDB entries)

8. Domain d4fcma_: 4fcm A: [197234]
   automated match to d3q90b_
   complexed with po4

Details for d4fcma_

PDB Entry: 4fcm, 2.69 Å

PDB Description: crystal structure of the ntf2-like domain of human g3bp1 in complex with a peptide

PDB Compounds: (A:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d4fcma_:

Sequence; same for both SEQRES and ATOM records:

>d4fcma_ d.17.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqkeihrkvm
sqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvankfyv
hndifryqdevf

Timeline for d4fcma_:

• d4fcma_ first appeared in SCOPe 2.02
  
• d4fcma_ appears in SCOPe 2.03
  
• d4fcma_ appears in SCOPe 2.05
  
• d4fcma_ appears in the current release, SCOPe 2.08