Lineage for d4faza_ (4faz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961572Species Methylibium petroleiphilum [TaxId:420662] [197231] (2 PDB entries)
  8. 2961573Domain d4faza_: 4faz A: [197232]
    automated match to d1otfa_
    complexed with so4

Details for d4faza_

PDB Entry: 4faz (more details), 1.57 Å

PDB Description: Kinetic and structural characterization of the 4-oxalocrotonate tautomerase isozymes from Methylibium petroleiphilum
PDB Compounds: (A:) 4-oxalocrotonate isomerase protein

SCOPe Domain Sequences for d4faza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4faza_ d.80.1.0 (A:) automated matches {Methylibium petroleiphilum [TaxId: 420662]}
pfaqiyliegrteeqkraviekvtqammeavgapkenvrvwihdvpkenwgiggvsakal
gr

SCOPe Domain Coordinates for d4faza_:

Click to download the PDB-style file with coordinates for d4faza_.
(The format of our PDB-style files is described here.)

Timeline for d4faza_: