SCOP 1.71: Domain d1cdu_1: 1cdu 1-97

Lineage for d1cdu_1 (1cdu 1-97)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (15 PDB entries)

8. Domain d1cdu_1: 1cdu 1-97 [19723]
   Other proteins in same PDB: d1cdu_2
   domain 1
   mutant

Details for d1cdu_1

PDB Entry: 1cdu, 2.7 Å

PDB Description: structure of t-cell surface glycoprotein cd4 mutant with phe 43 replaced by val

SCOP Domain Sequences for d1cdu_1:

Sequence; same for both SEQRES and ATOM records:

>d1cdu_1 b.1.1.1 (1-97) CD4 V-set domains {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsvltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d1cdu_1:

• d1cdu_1 first appeared (with stable ids) in SCOP 1.55
  
• d1cdu_1 appears in SCOP 1.69
  
• d1cdu_1 is called d1cdua1 in SCOP 1.73
  
• d1cdu_1 appears in the current release, SCOPe 2.08, called d1cdua1