Lineage for d4aj6b_ (4aj6 B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168058Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1168324Protein automated matches [190442] (10 species)
    not a true protein
  7. 1168356Species Litopenaeus vannamei [TaxId:6689] [197071] (3 PDB entries)
  8. 1168362Domain d4aj6b_: 4aj6 B: [197217]
    automated match to d1xwaa_
    complexed with act, dtt, gol

Details for d4aj6b_

PDB Entry: 4aj6 (more details), 2 Å

PDB Description: Crystallographic structure of thioredoxin from Litopenaeus vannamei (reduced form).
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d4aj6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aj6b_ c.47.1.1 (B:) automated matches {Litopenaeus vannamei [TaxId: 6689]}
mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk

SCOPe Domain Coordinates for d4aj6b_:

Click to download the PDB-style file with coordinates for d4aj6b_.
(The format of our PDB-style files is described here.)

Timeline for d4aj6b_: