![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
![]() | Protein CD4 V-set domains [48737] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48738] (26 PDB entries) |
![]() | Domain d1g9mc1: 1g9m C:1-97 [19721] Other proteins in same PDB: d1g9mc2, d1g9mg_, d1g9mh1, d1g9mh2, d1g9ml1, d1g9ml2 domain 1 complexed with fuc, ioh, nag; mutant |
PDB Entry: 1g9m (more details), 2.2 Å
SCOP Domain Sequences for d1g9mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9mc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1g9mc1: