Lineage for d4k67a_ (4k67 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117012Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1117013Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 1117058Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1117059Protein Hemagglutinin [49824] (5 species)
    includes rudiment esterase domain
  7. 1117068Species Influenza A virus, different strains [TaxId:11320] [49825] (61 PDB entries)
  8. 1117157Domain d4k67a_: 4k67 A: [197203]
    automated match to d2fk0a1
    complexed with nag; mutant

Details for d4k67a_

PDB Entry: 4k67 (more details), 2.7 Å

PDB Description: structure of an airborne transmissible avian influenza h5 hemagglutinin mutant from the influenza virus a/indonesia/5/2005 complexed with human receptor analog lstc
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4k67a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k67a_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanptndlcypgsfndyeelkyllsrinhfekiqiipk
sswsdheassgvssacpylgspsffrnvvwlikknsayptikksynntnqedllvlwgih
hpndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvnglssrmeffwtilkpndai
nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlatglrns

SCOPe Domain Coordinates for d4k67a_:

Click to download the PDB-style file with coordinates for d4k67a_.
(The format of our PDB-style files is described here.)

Timeline for d4k67a_: