Lineage for d4jnja_ (4jnj A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1133645Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1133646Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1133647Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1133951Protein automated matches [190191] (2 species)
    not a true protein
  7. 1134019Species Streptomyces avidinii [TaxId:1895] [189343] (8 PDB entries)
  8. 1134032Domain d4jnja_: 4jnj A: [197198]
    automated match to d1rxkb_
    complexed with btn, zn

Details for d4jnja_

PDB Entry: 4jnj (more details), 1.9 Å

PDB Description: Structure based engineering of streptavidin monomer with a reduced biotin dissociation rate
PDB Compounds: (A:) Streptavidin/Rhizavidin Hybrid

SCOPe Domain Sequences for d4jnja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jnja_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gaeagitgtwynqsgstftvtagadgnltgqyenraqgtgcqnspytltgryngtklewr
vewnnstenchsrtewrgqyqggaearintqwnltyeggsgpateqgqdtftkvk

SCOPe Domain Coordinates for d4jnja_:

Click to download the PDB-style file with coordinates for d4jnja_.
(The format of our PDB-style files is described here.)

Timeline for d4jnja_: