Lineage for d4haac_ (4haa C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1190017Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 1190018Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 1190019Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 1190210Protein automated matches [190834] (2 species)
    not a true protein
  7. 1190211Species Bacillus intermedius [TaxId:1400] [194484] (1 PDB entry)
  8. 1190214Domain d4haac_: 4haa C: [197181]
    automated match to d4haab_
    mutant

Details for d4haac_

PDB Entry: 4haa (more details), 1.9 Å

PDB Description: Structure of Ribonuclease Binase Glu43Ala/Phe81Ala Mutant
PDB Compounds: (C:) Ribonuclease

SCOPe Domain Sequences for d4haac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4haac_ d.1.1.2 (C:) automated matches {Bacillus intermedius [TaxId: 1400]}
avintfdgvadylirykrlpdnyitksqasalgwvaskgnlaavapgksiggdvfsnreg
rlpsasgrtwreadinyvsgarnadrlvyssdwliykttdhyatftrir

SCOPe Domain Coordinates for d4haac_:

Click to download the PDB-style file with coordinates for d4haac_.
(The format of our PDB-style files is described here.)

Timeline for d4haac_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4haad_