Lineage for d1bqhk_ (1bqh K:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352601Protein CD8 [48734] (3 species)
  7. 2352610Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries)
  8. 2352618Domain d1bqhk_: 1bqh K: [19718]
    Other proteins in same PDB: d1bqha1, d1bqha2, d1bqhb_, d1bqhd1, d1bqhd2, d1bqhe_, d1bqhi2
    complexed with nag, ndg

Details for d1bqhk_

PDB Entry: 1bqh (more details), 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8
PDB Compounds: (K:) protein (cd8a or lyt2 or lyt-2)

SCOPe Domain Sequences for d1bqhk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqhk_ b.1.1.1 (K:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
kvssa

SCOPe Domain Coordinates for d1bqhk_:

Click to download the PDB-style file with coordinates for d1bqhk_.
(The format of our PDB-style files is described here.)

Timeline for d1bqhk_: