SCOPe 2.02: Domain d4g8zx_: 4g8z X:

Lineage for d4g8zx_ (4g8z X:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (10 species)
   not a true protein

7. Species Pneumocystis jirovecii [TaxId:42068] [197174] (1 PDB entry)

8. Domain d4g8zx_: 4g8z X: [197175]
   automated match to d1dyra_
   complexed with ndp, top; mutant

Details for d4g8zx_

PDB Entry: 4g8z, 1.75 Å

PDB Description: pcDHFR K37S/F69N double mutant TMP NADPH ternary complex

PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d4g8zx_:

Sequence; same for both SEQRES and ATOM records:

>d4g8zx_ c.71.1.1 (X:) automated matches {Pneumocystis jirovecii [TaxId: 42068]}
qqksltlivalttsygigrsnslpwklkkeisyfsrvtsfvptfdsfesmnvvlmgrktw
esiplqnrplkgrinvvitrnaaaaaaaaihsaksldhalellyrtygsessvqinrifv
iggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswvg
tkvphgkinedgfdyefemwtrdl

Timeline for d4g8zx_:

• d4g8zx_ is new in SCOPe 2.02-stable
  
• d4g8zx_ appears in SCOPe 2.03
  
• d4g8zx_ appears in the current release, SCOPe 2.08