![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein CD8 [48734] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries) |
![]() | Domain d1bqhi_: 1bqh I: [19717] Other proteins in same PDB: d1bqha1, d1bqha2, d1bqhb_, d1bqhd1, d1bqhd2, d1bqhe_ complexed with nag, ndg |
PDB Entry: 1bqh (more details), 2.8 Å
SCOPe Domain Sequences for d1bqhi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqhi_ b.1.1.1 (I:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvs sa
Timeline for d1bqhi_: