Lineage for d1bqhh_ (1bqh H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929433Protein CD8 [48734] (3 species)
  7. 929442Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries)
  8. 929450Domain d1bqhh_: 1bqh H: [19716]
    Other proteins in same PDB: d1bqha1, d1bqha2, d1bqhb_, d1bqhd1, d1bqhd2, d1bqhe_
    complexed with nag, ndg

Details for d1bqhh_

PDB Entry: 1bqh (more details), 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8
PDB Compounds: (H:) protein (cd8a or lyt2 or lyt-2)

SCOPe Domain Sequences for d1bqhh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqhh_ b.1.1.1 (H:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
kvssa

SCOPe Domain Coordinates for d1bqhh_:

Click to download the PDB-style file with coordinates for d1bqhh_.
(The format of our PDB-style files is described here.)

Timeline for d1bqhh_: