SCOP 1.61: Domain d1bqhh_: 1bqh H:

Lineage for d1bqhh_ (1bqh H:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein CD8 [48734] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48736] (1 PDB entry)

8. Domain d1bqhh_: 1bqh H: [19716]
   Other proteins in same PDB: d1bqha1, d1bqha2, d1bqhb1, d1bqhd1, d1bqhd2, d1bqhe1

Details for d1bqhh_

PDB Entry: 1bqh, 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8

SCOP Domain Sequences for d1bqhh_:

Sequence; same for both SEQRES and ATOM records:

>d1bqhh_ b.1.1.1 (H:) CD8 {Mouse (Mus musculus)}
kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
kvssa

Timeline for d1bqhh_:

• d1bqhh_ first appeared (with stable ids) in SCOP 1.55
  
• d1bqhh_ appears in SCOP 1.59
  
• d1bqhh_ appears in SCOP 1.63
  
• d1bqhh_ appears in the current release, SCOPe 2.08