SCOPe 2.06: Domain d4f08b_: 4f08 B:

Lineage for d4f08b_ (4f08 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries)

8. Domain d4f08b_: 4f08 B: [197155]
   automated match to d3q32b_
   complexed with 1rs

Details for d4f08b_

PDB Entry: 4f08, 2.82 Å

PDB Description: Discovery and Optimization of C-2 Methyl Imidazo-pyrrolopyridines as Potent and Orally Bioavailable JAK1 Inhibitors with Selectivity over JAK2

PDB Compounds: (B:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d4f08b_:

Sequence; same for both SEQRES and ATOM records:

>d4f08b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfereieil
kslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsqick
gmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespifwya
peslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhliell
knngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag

Timeline for d4f08b_:

• d4f08b_ first appeared in SCOPe 2.02
  
• d4f08b_ appears in SCOPe 2.05
  
• d4f08b_ appears in SCOPe 2.07
  
• d4f08b_ appears in the current release, SCOPe 2.08