SCOPe 2.02: Domain d4isnb_: 4isn B:

Lineage for d4isnb_ (4isn B:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.0: automated matches [191505] (1 protein)
   not a true family

6. Protein automated matches [190829] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188132] (3 PDB entries)

8. Domain d4isnb_: 4isn B: [197096]
   Other proteins in same PDB: d4isna_
   automated match to d1yc0i_
   complexed with gsh, pg4

Details for d4isnb_

PDB Entry: 4isn, 2.45 Å

PDB Description: crystal structure of matriptase in complex with its inhibitor hai-1

PDB Compounds: (B:) Kunitz-type protease inhibitor 1

SCOPe Domain Sequences for d4isnb_:

Sequence; same for both SEQRES and ATOM records:

>d4isnb_ g.8.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtedyclasnkvgrcrgsfprwyydpteqicksfvyggclgnknnylreeecilacrgvq
gp

Timeline for d4isnb_:

• d4isnb_ is new in SCOPe 2.02-stable
  
• d4isnb_ appears in SCOPe 2.03
  
• d4isnb_ appears in the current release, SCOPe 2.08