SCOPe 2.03: Domain d1qfob_: 1qfo B:

Lineage for d1qfob_ (1qfo B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein N-terminal domain of sialoadhesin [48732] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48733] (6 PDB entries)
   Uniprot Q62230 20-130

8. Domain d1qfob_: 1qfo B: [19709]
   complexed with sia

Details for d1qfob_

PDB Entry: 1qfo, 1.85 Å

PDB Description: n-terminal domain of sialoadhesin (mouse) in complex with 3'sialyllactose

PDB Compounds: (B:) protein (sialoadhesin)

SCOPe Domain Sequences for d1qfob_:

Sequence, based on SEQRES records:

>d1qfob_ b.1.1.1 (B:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvtt

Sequence, based on observed residues (ATOM records):

>d1qfob_ b.1.1.1 (B:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsgitaiwyydysgkrqvvihsgdpklvd
krfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeissnrwldvkgttvtvtt

Timeline for d1qfob_:

• d1qfob_ first appeared (with stable ids) in SCOP 1.55
  
• d1qfob_ appears in SCOPe 2.02
  
• d1qfob_ appears in SCOPe 2.04
  
• d1qfob_ appears in the current release, SCOPe 2.08