Lineage for d1f5wa_ (1f5w A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48731] (2 PDB entries) 
Domain d1f5wa_: 1f5w A: [19705]
Details for d1f5wa_
PDB Entry: 1f5w (more details), 1.7 Å
PDB Description: dimeric structure of the coxsackie virus and adenovirus receptor d1 domain
SCOP Domain Sequences for d1f5wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5wa_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens)}
farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
vvlv
SCOP Domain Coordinates for d1f5wa_:
Click to download the PDB-style file with coordinates for d1f5wa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f5wa_:
- d1f5wa_ appears in SCOP 1.57
- d1f5wa_ appears in the current release, SCOPe 2.08
View in 3D
