Lineage for d1neu__ (1neu -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 8101Protein Myelin membrane adhesion molecule P0 [48728] (1 species)
  7. 8102Species Rat (Rattus norvegicus) [TaxId:10116] [48729] (1 PDB entry)
  8. 8103Domain d1neu__: 1neu - [19704]

Details for d1neu__

PDB Entry: 1neu (more details), 1.9 Å

PDB Description: structure of myelin membrane adhesion molecule p0

SCOP Domain Sequences for d1neu__:

Sequence, based on SEQRES records: (download)

>d1neu__ b.1.1.1 (-) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus)}
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknppdivgktsqvtlyvfe

Sequence, based on observed residues (ATOM records): (download)

>d1neu__ b.1.1.1 (-) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus)}
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknvgktsqvtlyvfe

SCOP Domain Coordinates for d1neu__:

Click to download the PDB-style file with coordinates for d1neu__.
(The format of our PDB-style files is described here.)

Timeline for d1neu__: