Lineage for d4kd5a_ (4kd5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915414Species Clostridium difficile [TaxId:272563] [197037] (2 PDB entries)
  8. 2915417Domain d4kd5a_: 4kd5 A: [197038]
    automated match to d1amfa_
    complexed with fmt, sbt, so4

Details for d4kd5a_

PDB Entry: 4kd5 (more details), 2.5 Å

PDB Description: substrate binding domain of putative molybdenum abc transporter from clostridium difficile
PDB Compounds: (A:) ABC-type transport system, molybdenum-specific extracellular solute-binding protein

SCOPe Domain Sequences for d4kd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kd5a_ c.94.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
svelnisaaaslkeamakieeeykkvdsnvkltvnygasgslqqqieqgapcdlfisagq
kqmkvldeekllvsdtmkdlvkndlvlissadssvsgmkdlttdkvkkiavgeaesvpag
kyadevltnlnlkdklkdklvfakdvkevlawvqsgnadvgfvyfsdtvnndkikvvekt
dekthspitypvsvikasknvdaakkfeefllsesgqkifeefgykkve

SCOPe Domain Coordinates for d4kd5a_:

Click to download the PDB-style file with coordinates for d4kd5a_.
(The format of our PDB-style files is described here.)

Timeline for d4kd5a_: