Lineage for d1d4cc1 (1d4c C:3-102)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101664Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 101665Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 101717Family a.138.1.3: Di-heme elbow motif [48711] (5 proteins)
  6. 101738Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (2 species)
  7. 101750Species Shewanella putrefaciens [TaxId:24] [48723] (3 PDB entries)
  8. 101753Domain d1d4cc1: 1d4c C:3-102 [19700]
    Other proteins in same PDB: d1d4ca2, d1d4ca3, d1d4cb2, d1d4cb3, d1d4cc2, d1d4cc3, d1d4cd2, d1d4cd3

Details for d1d4cc1

PDB Entry: 1d4c (more details), 2.9 Å

PDB Description: crystal structure of the uncomplexed form of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1

SCOP Domain Sequences for d1d4cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4cc1 a.138.1.3 (C:3-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella putrefaciens}
evladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsphks
hligeiactschkgheksvaycdachsfgfdmpfggkwer

SCOP Domain Coordinates for d1d4cc1:

Click to download the PDB-style file with coordinates for d1d4cc1.
(The format of our PDB-style files is described here.)

Timeline for d1d4cc1: