SCOPe 2.02: Domain d3u9pc_: 3u9p C:

Lineage for d3u9pc_ (3u9p C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188249] (8 PDB entries)

8. Domain d3u9pc_: 3u9p C: [196983]
   automated match to d3s26a_

Details for d3u9pc_

PDB Entry: 3u9p, 2.8 Å

PDB Description: crystal structure of murine siderocalin in complex with an fab fragment

PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3u9pc_:

Sequence, based on SEQRES records:

>d3u9pc_ b.60.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lipapslltvplqpdfrsdqfrgrwyvvglagnavqkktegsftmystiyelqennsynv
tsilvrdqdqgcrywirtfvpssragqftlgnmhrypqvqsynvqvattdynqfamvffr
ktsenkqyfkitlygrtkelspelkerftrfakslglkddniifsvptdqcidn

Sequence, based on observed residues (ATOM records):

>d3u9pc_ b.60.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lipapslltvplqpdfrsdqfrgrwyvvglagnavqkktegsftmystiyelqennsynv
tsilvrcrywirtfvpssragqftlgnmhrypqvqsynvqvattdynqfamvffrktsen
kqyfkitlygrtkelspelkerftrfakslglkddniifsvptdqcidn

Timeline for d3u9pc_:

• d3u9pc_ is new in SCOPe 2.02-stable
  
• d3u9pc_ appears in SCOPe 2.03
  
• d3u9pc_ appears in the current release, SCOPe 2.08