Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.261: Hypothetical protein PH1602 [103364] (1 superfamily) complex alpha+beta fold; contains a region of similarity to the ferredoxin-like fold |
Superfamily d.261.1: Hypothetical protein PH1602 [103365] (2 families) |
Family d.261.1.1: Hypothetical protein PH1602 [103366] (2 proteins) |
Protein automated matches [194738] (2 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:70601] [196969] (1 PDB entry) |
Domain d4iszb_: 4isz B: [196970] automated match to d1uc2a_ protein/RNA complex; complexed with gav, mn, so4, suc |
PDB Entry: 4isz (more details), 2.3 Å
SCOPe Domain Sequences for d4iszb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iszb_ d.261.1.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]} vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg
Timeline for d4iszb_: