Lineage for d1qo8d1 (1qo8 D:2-102)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6906Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 6907Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 6954Family a.138.1.3: Di-heme elbow motif [48711] (5 proteins)
  6. 6975Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (2 species)
  7. 6976Species Shewanella frigidimarina [TaxId:56812] [48722] (3 PDB entries)
  8. 6980Domain d1qo8d1: 1qo8 D:2-102 [19697]
    Other proteins in same PDB: d1qo8a2, d1qo8a3, d1qo8d2, d1qo8d3

Details for d1qo8d1

PDB Entry: 1qo8 (more details), 2.15 Å

PDB Description: the structure of the open conformation of a flavocytochrome c3 fumarate reductase

SCOP Domain Sequences for d1qo8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo8d1 a.138.1.3 (D:2-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina}
tpdmgsfhadmgscqschakpikvtdsethenaqckschgeyaelandklqfdphnshlg
dinctschkgheepkfycnechsfdikpmpfsdakkkkswd

SCOP Domain Coordinates for d1qo8d1:

Click to download the PDB-style file with coordinates for d1qo8d1.
(The format of our PDB-style files is described here.)

Timeline for d1qo8d1: