SCOPe 2.02: Domain d4h8qa_: 4h8q A:

Lineage for d4h8qa_ (4h8q A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (1 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:1392] [195437] (4 PDB entries)

8. Domain d4h8qa_: 4h8q A: [196958]
   automated match to d2o6pa1
   complexed with hem, zn; mutant

Details for d4h8qa_

PDB Entry: 4h8q, 1.7 Å

PDB Description: Structure of the Q29T IsdX2-NEAT5 mutant in complex with heme

PDB Compounds: (A:) Iron Transport-associated domain protein

SCOPe Domain Sequences for d4h8qa_:

Sequence; same for both SEQRES and ATOM records:

>d4h8qa_ b.1.28.0 (A:) automated matches {Bacillus anthracis [TaxId: 1392]}
lkdgqydiafkvlkdkteeismmntyvvsparltvkdgkkyiamtlknsewitkfqtekn
ggfadakvvsedkaantrvvefeandlfaklnakvkvdidsmnyhhfydvqiqfdptki

Timeline for d4h8qa_:

• d4h8qa_ is new in SCOPe 2.02-stable
  
• d4h8qa_ appears in SCOPe 2.03
  
• d4h8qa_ appears in the current release, SCOPe 2.08