![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins) automatically mapped to Pfam PF01653 |
![]() | Protein automated matches [194553] (3 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:1351] [196940] (1 PDB entry) |
![]() | Domain d4efea_: 4efe A: [196941] automated match to d1taea_ protein/DNA complex; complexed with 0ov, nmn, so4 |
PDB Entry: 4efe (more details), 2 Å
SCOPe Domain Sequences for d4efea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4efea_ d.142.2.2 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]} pltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlitpds ptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelkidgl aislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkqsfv alneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqfeal eelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdelgft vkaprwaiaykfp
Timeline for d4efea_: