SCOP 1.75: Domain d1fs9a_: 1fs9 A:

Lineage for d1fs9a_ (1fs9 A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Cytochrome c nitrite reductase [48718] (4 species)

7. Species Wolinella succinogenes [TaxId:844] [48720] (6 PDB entries)

8. Domain d1fs9a_: 1fs9 A: [19693]
   complexed with azi, ca, hem, y1

Details for d1fs9a_

PDB Entry: 1fs9, 2 Å

PDB Description: cytochrome c nitrite reductase from wolinella succinogenes-azide complex

PDB Compounds: (A:) cytochrome c nitrite reductase

SCOP Domain Sequences for d1fs9a_:

Sequence; same for both SEQRES and ATOM records:

>d1fs9a_ a.138.1.3 (A:) Cytochrome c nitrite reductase {Wolinella succinogenes [TaxId: 844]}
ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy
naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa
kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv
eyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq
hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk
lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma
iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak
vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk

Timeline for d1fs9a_:

• d1fs9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fs9a_ appears in SCOP 1.73
  
• d1fs9a_ appears in SCOPe 2.01
  
• d1fs9a_ appears in the current release, SCOPe 2.08