Lineage for d4japa_ (4jap A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1186520Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1186521Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1187138Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1187139Protein automated matches [196909] (1 species)
    not a true protein
  7. 1187140Species Mycobacterium tuberculosis [TaxId:1773] [196910] (2 PDB entries)
  8. 1187141Domain d4japa_: 4jap A: [196911]
    automated match to d1tedb_
    complexed with 14u, coa, plm

Details for d4japa_

PDB Entry: 4jap (more details), 1.83 Å

PDB Description: Crystal Structure of Mycobacterium tuberculosis PKS11 Reveals Intermediates in the Synthesis of Methyl-branched Alkylpyrones
PDB Compounds: (A:) Alpha-pyrone synthesis polyketide synthase-like Pks11

SCOPe Domain Sequences for d4japa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4japa_ c.95.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msviagvfgalpphrysqseitdsfvefpglkeheeiirrlhaaakvngrhlvlplqqyp
sltdfgdaneifiekavdlgveallgalddanlrpsdidmiatatvtgvavpsldariag
rlglrpdvrrmplfglgcvagaagvarlrdylrgapddvavlvsvelcsltypavkptvs
slvgtalfgdgaaavvavgdrraeqvraggpdildsrsslypdslhimgwdvgshglrlr
lspdltnlierylandvttfldahrltkddigawvshpggpkvidavatslalppealel
twrslgeignlssasilhilrdtiekrppsgsaglmlamgpgfctelvllrwr

SCOPe Domain Coordinates for d4japa_:

Click to download the PDB-style file with coordinates for d4japa_.
(The format of our PDB-style files is described here.)

Timeline for d4japa_: