Lineage for d4i4fa_ (4i4f A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434673Protein Focal adhesion kinase 1 (fak) [103292] (2 species)
    PTK group; FAK subfamily; non-membrane spanning protein tyrosine kinase
  7. 1434677Species Human (Homo sapiens) [TaxId:9606] [103293] (12 PDB entries)
  8. 1434681Domain d4i4fa_: 4i4f A: [196903]
    automated match to d2etmb_
    complexed with 1br, ipa

Details for d4i4fa_

PDB Entry: 4i4f (more details), 1.75 Å

PDB Description: Structure of Focal Adhesion Kinase catalytic domain in complex with an allosteric binding pyrazolobenzothiazine compound.
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d4i4fa_:

Sequence, based on SEQRES records: (download)

>d4i4fa_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
yeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqealt
mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
ayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapesi
nfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlysl
mtkcwaydpsrrprftelkaqlstileeekaq

Sequence, based on observed residues (ATOM records): (download)

>d4i4fa_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
yeiqrerielgrcigegqfgdvhqgiymspalavaiktcknctsdsvrekflqealtmrq
fdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstalayl
eskrfvhrdiaarnvlvssndcvklgdfglsklpikwmapesinfrrftsasdvwmfgvc
mweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprfte
lkaqlstileeekaq

SCOPe Domain Coordinates for d4i4fa_:

Click to download the PDB-style file with coordinates for d4i4fa_.
(The format of our PDB-style files is described here.)

Timeline for d4i4fa_: