SCOPe 2.02: Domain d4fpic_: 4fpi C:

Lineage for d4fpic_ (4fpi C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (7 species)
   not a true protein

7. Species Rhodococcus opacus [TaxId:37919] [196895] (3 PDB entries)

8. Domain d4fpic_: 4fpi C: [196896]
   automated match to d1mlia_

Details for d4fpic_

PDB Entry: 4fpi, 2.2 Å

PDB Description: Crystal Structure of 5-chloromuconolactone isomerase from Rhodococcus opacus 1CP

PDB Compounds: (C:) 5-chloromuconolactone dehalogenase

SCOPe Domain Sequences for d4fpic_:

Sequence; same for both SEQRES and ATOM records:

>d4fpic_ d.58.4.0 (C:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnldsreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns
hdelheilwslpffpyltidveplshhparvgkd

Timeline for d4fpic_:

• d4fpic_ is new in SCOPe 2.02-stable
  
• d4fpic_ appears in SCOPe 2.03
  
• d4fpic_ appears in the current release, SCOPe 2.08