SCOPe 2.08: Domain d4eigb1: 4eig B:1-116

Lineage for d4eigb1 (4eig B:1-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4eigb1: 4eig B:1-116 [196883]
   Other proteins in same PDB: d4eiga_, d4eigb2
   automated match to d3ezjb_

Details for d4eigb1

PDB Entry: 4eig, 2.5 Å

PDB Description: ca1698 camel antibody fragment in complex with dhfr

PDB Compounds: (B:) CA1698 camel antibody fragment

SCOPe Domain Sequences for d4eigb1:

Sequence; same for both SEQRES and ATOM records:

>d4eigb1 b.1.1.1 (B:1-116) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlsckasgiifsvykmtwyrqapgkerelvalittnnntmtv
dsvkgrftisrdnvqntvylemnnlkpedtavyycnanrglagpaywgqgtqvtvs

Timeline for d4eigb1:

• d4eigb1 first appeared in SCOPe 2.02, called d4eigb_
  
• d4eigb1 appears in SCOPe 2.07