SCOPe 2.06: Domain d4eizd1: 4eiz D:2-127

Lineage for d4eizd1 (4eiz D:2-127)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)

8. Domain d4eizd1: 4eiz D:2-127 [196882]
   Other proteins in same PDB: d4eiza_, d4eizb_, d4eizc2, d4eizd2
   automated match to d2xa3a_

Details for d4eizd1

PDB Entry: 4eiz, 2.2 Å

PDB Description: Structure of Nb113 bound to apoDHFR

PDB Compounds: (D:) Nb113 Camel antibody fragment

SCOPe Domain Sequences for d4eizd1:

Sequence; same for both SEQRES and ATOM records:

>d4eizd1 b.1.1.1 (D:2-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlsctasgrtfssyamgwfrqtpgkerefvaaitwggsttlya
dsvkgrftmsrdnakntvylqmnslkpedtavyycaadgsqyrstysfrdkpdygswgqg
tqvtvs

Timeline for d4eizd1:

• d4eizd1 first appeared in SCOPe 2.02, called d4eizd_
  
• d4eizd1 was called d4eizd_ in SCOPe 2.05
  
• d4eizd1 appears in SCOPe 2.07
  
• d4eizd1 appears in the current release, SCOPe 2.08