Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (7 species) not a true protein |
Species Homo sapiens [TaxId:9606] [192744] (16 PDB entries) |
Domain d3zh8b_: 3zh8 B: [196875] automated match to d3a8xa_ complexed with c58, cl, edo, iod |
PDB Entry: 3zh8 (more details), 2.74 Å
SCOPe Domain Sequences for d3zh8b_:
Sequence, based on SEQRES records: (download)
>d3zh8b_ d.144.1.0 (B:) automated matches {Homo sapiens [TaxId: 9606]} slglqdfdllrvigrgsyakvllvrlkktdriyamkvvkkelvnddedidwvqtekhvfe qasnhpflvglhscfqtesrlffvieyvnggdlmfhmqrqrklpeeharfysaeislaln ylhergiiyrdlkldnvlldseghikltdygmckeglrpgdttstfcgtpnyiapeilrg edygfsvdwwalgvlmfemmagrspfdivgssdnpdqntedylfqvilekqiriprslsv kaasvlksflnkdpkerlgchpqtgfadiqghpffrnvdwdmmeqkqvvppfkpnisgef gldnfdsqftnepvqltpddddivrkidqsefegfeyinpll
>d3zh8b_ d.144.1.0 (B:) automated matches {Homo sapiens [TaxId: 9606]} slglqdfdllrvigrgsyakvllvrlkktdriyamkvvkkelvnddedidwvqtekhvfe qasnhpflvglhscfqtesrlffvieyvnggdlmfhmqrqrklpeeharfysaeislaln ylhergiiyrdlkldnvlldseghikltdygmckeglrpgdttstfcgtpnyiapeilrg edygfsvdwwalgvlmfemmagrspfdivntedylfqvilekqiriprslsvkaasvlks flnkdpkerlgchpqtgfadiqghpffrnvdwdmmeqkqvvppfkpnisgeqltpddddi vrkidqsefegfeyinpll
Timeline for d3zh8b_: