SCOP 1.71: Domain d1ft5a_: 1ft5 A:

Lineage for d1ft5a_ (1ft5 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Cytochrome c554 [48714] (1 species)
   contains 1 complete motif

7. Species Nitrosomonas europaea [TaxId:915] [48715] (3 PDB entries)

8. Domain d1ft5a_: 1ft5 A: [19681]
   complexed with hem, ips

Details for d1ft5a_

PDB Entry: 1ft5, 1.6 Å

PDB Description: crystal structure of the oxidized state of cytochrome c554 from nitrosomonas europaea

SCOP Domain Sequences for d1ft5a_:

Sequence; same for both SEQRES and ATOM records:

>d1ft5a_ a.138.1.3 (A:) Cytochrome c554 {Nitrosomonas europaea}
adapfegrkkcsschkaqaqswkdtahakameslkpnvkkeakqkakldpakdytqdkdc
vgchvdgfgqkggytiespkpmltgvgceschgpgrnfrgdhrksgqafeksgkktprkd
lakkgqdfhfeercsachlnyegspwkgakapytpftpevdakytfkfdemvkevkamhe
hyklegvfegepkfkfhdefqasakpakkgk

Timeline for d1ft5a_:

• d1ft5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ft5a_ appears in SCOP 1.69
  
• d1ft5a_ appears in SCOP 1.73
  
• d1ft5a_ appears in the current release, SCOPe 2.08