SCOPe 2.02: Domain d1zvnb_: 1zvn B:

Lineage for d1zvnb_ (1zvn B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (2 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [196808] (1 PDB entry)

8. Domain d1zvnb_: 1zvn B: [196809]
   automated match to d2a4ca_

Details for d1zvnb_

PDB Entry: 1zvn, 2.16 Å

PDB Description: Crystal structure of chick MN-cadherin EC1

PDB Compounds: (B:) Cadherin 1

SCOPe Domain Sequences for d1zvnb_:

Sequence; same for both SEQRES and ATOM records:

>d1zvnb_ b.1.6.0 (B:) automated matches {Gallus gallus [TaxId: 9031]}
sgwvwnqffvleeytgtdplyvgklhsdmdrgdgsikyilsgegagivftiddttgdiha
iqrldreersqytlraqaldrrtgrpmepesefiikiqd

Timeline for d1zvnb_:

• d1zvnb_ is new in SCOPe 2.02-stable
  
• d1zvnb_ appears in SCOPe 2.03
  
• d1zvnb_ appears in the current release, SCOPe 2.08, called d1zvnb1