SCOPe 2.08: Domain d1zvnb1: 1zvn B:2-98

Lineage for d1zvnb1 (1zvn B:2-98)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries)

8. Domain d1zvnb1: 1zvn B:2-98 [196809]
   Other proteins in same PDB: d1zvna2, d1zvnb2
   automated match to d2a4ca_

Details for d1zvnb1

PDB Entry: 1zvn, 2.16 Å

PDB Description: Crystal structure of chick MN-cadherin EC1

PDB Compounds: (B:) Cadherin 1

SCOPe Domain Sequences for d1zvnb1:

Sequence; same for both SEQRES and ATOM records:

>d1zvnb1 b.1.6.0 (B:2-98) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
wvwnqffvleeytgtdplyvgklhsdmdrgdgsikyilsgegagivftiddttgdihaiq
rldreersqytlraqaldrrtgrpmepesefiikiqd

Timeline for d1zvnb1:

• d1zvnb1 first appeared in SCOPe 2.02, called d1zvnb_
  
• d1zvnb1 appears in SCOPe 2.07