Class a: All alpha proteins [46456] (290 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins) consists of four heme-binding repeats automatically mapped to Pfam PF02276 |
Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species) |
Species Thermochromatium tepidum [TaxId:1050] [48710] (1 PDB entry) |
Domain d1eysc_: 1eys C: [19678] Other proteins in same PDB: d1eysh1, d1eysh2, d1eysl_, d1eysm_ complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef |
PDB Entry: 1eys (more details), 2.2 Å
SCOPe Domain Sequences for d1eysc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eysc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Thermochromatium tepidum [TaxId: 1050]} cegpppgteqigyrgvgmenyyvkrqralsiqanqpveslpaadstgpkasevyqsvqvl kdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvraansdwk ahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslpfdpltp fldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctschntrafndwtqs tpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnkplygaq makdypglyk
Timeline for d1eysc_:
View in 3D Domains from other chains: (mouse over for more information) d1eysh1, d1eysh2, d1eysl_, d1eysm_ |