SCOPe 2.08: Domain d1eysc_: 1eys C:

Lineage for d1eysc_ (1eys C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Thermochromatium tepidum [TaxId:1050] [48710] (1 PDB entry)

8. Domain d1eysc_: 1eys C: [19678]
   Other proteins in same PDB: d1eysh1, d1eysh2, d1eysl_, d1eysm_
   complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef

Details for d1eysc_

PDB Entry: 1eys, 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum

PDB Compounds: (C:) photosynthetic reaction center

SCOPe Domain Sequences for d1eysc_:

Sequence; same for both SEQRES and ATOM records:

>d1eysc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Thermochromatium tepidum [TaxId: 1050]}
cegpppgteqigyrgvgmenyyvkrqralsiqanqpveslpaadstgpkasevyqsvqvl
kdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvraansdwk
ahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslpfdpltp
fldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctschntrafndwtqs
tpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnkplygaq
makdypglyk

Timeline for d1eysc_:

• d1eysc_ first appeared (with stable ids) in SCOP 1.55
  
• d1eysc_ appears in SCOPe 2.07