SCOP 1.67: Domain d7prcc_: 7prc C:

Lineage for d7prcc_ (7prc C:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
   consists of four heme-binding repeats

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (9 PDB entries)

8. Domain d7prcc_: 7prc C: [19677]
   Other proteins in same PDB: d7prch1, d7prch2, d7prcl_, d7prcm_
   complexed with 7mq, bcb, bpb, cet, fe2, hem, lda, ns5, so4

Details for d7prcc_

PDB Entry: 7prc, 2.65 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)

SCOP Domain Sequences for d7prcc_:

Sequence; same for both SEQRES and ATOM records:

>d7prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d7prcc_:

• d7prcc_ first appeared (with stable ids) in SCOP 1.55
  
• d7prcc_ appears in SCOP 1.65
  
• d7prcc_ appears in SCOP 1.69
  
• d7prcc_ appears in the current release, SCOPe 2.08