Lineage for d7prcc_ (7prc C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6906Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 6907Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 6941Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
  6. 6942Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 6943Species Rhodopseudomonas viridis [TaxId:1079] [48709] (8 PDB entries)
  8. 6951Domain d7prcc_: 7prc C: [19677]
    Other proteins in same PDB: d7prch1, d7prch2, d7prcl1, d7prcm1

Details for d7prcc_

PDB Entry: 7prc (more details), 2.65 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)

SCOP Domain Sequences for d7prcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOP Domain Coordinates for d7prcc_:

Click to download the PDB-style file with coordinates for d7prcc_.
(The format of our PDB-style files is described here.)

Timeline for d7prcc_: