Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (6 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [196757] (1 PDB entry) |
Domain d4dame_: 4dam E: [196761] automated match to d3a5ua_ |
PDB Entry: 4dam (more details), 1.7 Å
SCOPe Domain Sequences for d4dame_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dame_ b.40.4.0 (E:) automated matches {Streptomyces coelicolor [TaxId: 1902]} smneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanr qlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlargt
Timeline for d4dame_:
View in 3D Domains from other chains: (mouse over for more information) d4dama_, d4damb_, d4damc_, d4damd_ |