SCOPe 2.06: Domain d3w28a_: 3w28 A:

Lineage for d3w28a_ (3w28 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (90 species)
   not a true protein

7. Species Thermoanaerobacterium saccharolyticum [TaxId:1094508] [196751] (6 PDB entries)

8. Domain d3w28a_: 3w28 A: [196753]
   automated match to d3ms8a_
   mutant

Details for d3w28a_

PDB Entry: 3w28, 1.39 Å

PDB Description: the high-resolution crystal structure of tsxyla, intracellular xylanase from /thermoanaerobacterium saccharolyticum jw/sl-ys485/: the complex of the e251a mutant with xylotriose

PDB Compounds: (A:) Glycoside hydrolase family 10

SCOPe Domain Sequences for d3w28a_:

Sequence; same for both SEQRES and ATOM records:

>d3w28a_ c.1.8.0 (A:) automated matches {Thermoanaerobacterium saccharolyticum [TaxId: 1094508]}
tiqndipdlysvfkdyfpigvavdpsrlndadphaqltakhfnmlvaenamkpeslqpte
gnftfdnadkivdyaiahnmkmrghtllwhnqvpdwffqdpsdpskpasrdlllqrlrth
ittvldhfktkygsqnpiigwdvvnevlddngnlrnskwlqiigpdyiekafeyaheadp
smklfindynienngvktqamydlvkklknegvpingigmqmhisinsnidnikasiekl
aslgveiqvtaldmnmngdvsndallkqarlykqlfdlfkaekqyitavvfwgvsddvsw
lskpnapllfdsklqakpaywaiv

Timeline for d3w28a_:

• d3w28a_ first appeared in SCOPe 2.02
  
• d3w28a_ appears in SCOPe 2.05
  
• d3w28a_ appears in SCOPe 2.07
  
• d3w28a_ appears in the current release, SCOPe 2.08