Lineage for d4h7mb1 (4h7m B:7-225)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780333Species Trichoderma harzianum [TaxId:5544] [196740] (1 PDB entry)
  8. 2780335Domain d4h7mb1: 4h7m B:7-225 [196741]
    Other proteins in same PDB: d4h7ma2, d4h7ma3, d4h7mb2
    automated match to d1oa3a_

Details for d4h7mb1

PDB Entry: 4h7m (more details), 2.07 Å

PDB Description: The X-ray Crystal Structure of the Trichoderma harzianum Endoglucanase 3 from family GH12
PDB Compounds: (B:) endo-1,4-beta-glucanase

SCOPe Domain Sequences for d4h7mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h7mb1 b.29.1.11 (B:7-225) automated matches {Trichoderma harzianum [TaxId: 5544]}
qtsceqyavfsggngysvsnnlwgqsagsgfgcitvnslnsaaswhadwqwsggqnnvks
ypnvqiaipqkrivnsigsmpttaswsytgsnlradvaydlftasnpnhvtysgdyelmi
wlarygdigpigsaqgtvtingqswtlyygfngamqvysfvapstvtnwsgdvknffnyl
rdnkgypassqyvlsyqfgtepftgsgtlnvnswtasin

SCOPe Domain Coordinates for d4h7mb1:

Click to download the PDB-style file with coordinates for d4h7mb1.
(The format of our PDB-style files is described here.)

Timeline for d4h7mb1: