SCOPe 2.05: Domain d5prcc_: 5prc C:

Lineage for d5prcc_ (5prc C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (18 PDB entries)

8. Domain d5prcc_: 5prc C: [19673]
   Other proteins in same PDB: d5prch1, d5prch2, d5prcl_, d5prcm_
   complexed with atz, bcb, bpb, fe2, hem, lda, mq7, ns5, so4

Details for d5prcc_

PDB Entry: 5prc, 2.35 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (atrazine complex)

PDB Compounds: (C:) photosynthetic reaction center

SCOPe Domain Sequences for d5prcc_:

Sequence; same for both SEQRES and ATOM records:

>d5prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d5prcc_:

• d5prcc_ first appeared (with stable ids) in SCOP 1.55
  
• d5prcc_ appears in SCOPe 2.04
  
• d5prcc_ appears in SCOPe 2.06
  
• d5prcc_ appears in the current release, SCOPe 2.08