Lineage for d5prcc_ (5prc C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 157026Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 157027Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 157072Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
  6. 157073Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 157074Species Rhodopseudomonas viridis [TaxId:1079] [48709] (8 PDB entries)
  8. 157079Domain d5prcc_: 5prc C: [19673]
    Other proteins in same PDB: d5prch1, d5prch2, d5prcl1, d5prcm1

Details for d5prcc_

PDB Entry: 5prc (more details), 2.35 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (atrazine complex)

SCOP Domain Sequences for d5prcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOP Domain Coordinates for d5prcc_:

Click to download the PDB-style file with coordinates for d5prcc_.
(The format of our PDB-style files is described here.)

Timeline for d5prcc_: