SCOPe 2.02: Domain d4j9zb_: 4j9z B:

Lineage for d4j9zb_ (4j9z B:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
   oligomeric transmembrane alpha-helical protein

4. Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family)

5. Family f.15.1.1: Small-conductance potassium channel [81326] (3 proteins)

6. Protein automated matches [195257] (1 species)
   not a true protein

7. Species Rattus norvegicus [TaxId:10116] [195259] (2 PDB entries)

8. Domain d4j9zb_: 4j9z B: [196728]
   automated match to d1kkda_
   complexed with 1kp, ca, gol, so4

Details for d4j9zb_

PDB Entry: 4j9z, 1.66 Å

PDB Description: Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and NS309

PDB Compounds: (B:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d4j9zb_:

Sequence; same for both SEQRES and ATOM records:

>d4j9zb_ f.15.1.1 (B:) automated matches {Rattus norvegicus [TaxId: 10116]}
grkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqr
kflqaihqlrsvkmeqrklndqantlvdlaktqlehh

Timeline for d4j9zb_:

• d4j9zb_ is new in SCOPe 2.02-stable
  
• d4j9zb_ appears in SCOPe 2.03
  
• d4j9zb_ appears in the current release, SCOPe 2.08, called d4j9zb1