Lineage for d3prcc_ (3prc C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51478Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 51479Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 51517Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
  6. 51518Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 51519Species Rhodopseudomonas viridis [TaxId:1079] [48709] (8 PDB entries)
  8. 51522Domain d3prcc_: 3prc C: [19672]
    Other proteins in same PDB: d3prch1, d3prch2, d3prcl1, d3prcm1

Details for d3prcc_

PDB Entry: 3prc (more details), 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (qb-depleted)

SCOP Domain Sequences for d3prcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOP Domain Coordinates for d3prcc_:

Click to download the PDB-style file with coordinates for d3prcc_.
(The format of our PDB-style files is described here.)

Timeline for d3prcc_: